PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010107986.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 390aa    MW: 43477.5 Da    PI: 6.9422
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010107986.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32246301156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  XP_010107986.1 246 KQRRCWSPELHRRFVSALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 301
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.86243303IPR017930Myb domain
SuperFamilySSF466896.91E-18244304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-29244304IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-26246301IPR006447Myb domain, plants
PfamPF002499.1E-8248299IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MGSLPPELSL DITATFVPRT IGDFLREVSA IGNASERASK LDDFGKRLED EMRKIDAFKR  60
ELPLCMLLLN DAIEALKKES LQCATQNAQP VLEEFIPLKK DCEEHEELDK NIDNNEKKDN  120
DCNKDKKNWM SSVQLWNTDD DDPKKNSKTQ TKINEKGYPL ETEDPFHKRA FVAFKPYSAF  180
PVVRKEEKKE FSVHGLSLLT PGLKNPKEES VCGAQRSNSG RAVSSSPSNA QSNLRTGSAQ  240
QQSARKQRRC WSPELHRRFV SALQQLGGSQ VATPKQIREL MQVDGLTNDE VKSHLQKYRL  300
HTRRLPSATS APANQSVVVL GGLWMNQDQY GDSSKASSSQ SGSPQGPFQL AANGGGNPTT  360
GEDSMEDDEE SKSEGYSWKS HLHKQGKVDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107986.10.0Two-component response regulator
TrEMBLW9S9080.0W9S908_9R
STRINGVIT_03s0063g01060.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-52G2-like family protein